PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma12g00350.1
Common NameZOSMA_12G00350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family MIKC_MADS
Protein Properties Length: 214aa    MW: 24910.7 Da    PI: 10.2363
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma12g00350.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.54.2e-291059251
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     rienk+nrqvtf+kRr g+lKKA+E+SvLCdaeva i+fs +gkly ys+
  Zosma12g00350.1 10 RIENKINRQVTFCKRRSGLLKKAHEISVLCDAEVAAIVFSAKGKLYQYST 59
                     8***********************************************96 PP

2K-box851.6e-28891751399
            K-box  13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                      ++ + + e+ k+k++ie+L ++ R+l+GedL+sLs k+L+ LeqqLe++l+kiR++K+++l+++i +lq kek+l ++n++L+kkl+
  Zosma12g00350.1  89 EQGTRSLEYLKMKSKIESLCKNERNLMGEDLDSLSTKDLRVLEQQLESGLTKIRAQKTNMLFDSIADLQSKEKMLLQQNHSLEKKLK 175
                      4556678******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.637161IPR002100Transcription factor, MADS-box
CDDcd002653.33E-37273No hitNo description
SuperFamilySSF554551.96E-31284IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-30323IPR002100Transcription factor, MADS-box
PfamPF003197.6E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-303859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129714.0190180IPR002487Transcription factor, K-box
PfamPF014865.4E-2492174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MGRGRVELRR IENKINRQVT FCKRRSGLLK KAHEISVLCD AEVAAIVFSA KGKLYQYSTD  60
SRMENILERF ERHYYAGKHL PEPNFQYSEQ GTRSLEYLKM KSKIESLCKN ERNLMGEDLD  120
SLSTKDLRVL EQQLESGLTK IRAQKTNMLF DSIADLQSKE KMLLQQNHSL EKKLKNERNA  180
AMAKQTEMNQ RGKTKQDIRK SEPLPNLNVR YMH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_D8e-20811764103Developmental protein SEPALLATA 3
4ox0_C8e-20811764103Developmental protein SEPALLATA 3
4ox0_B8e-20811764103Developmental protein SEPALLATA 3
4ox0_A8e-20811764103Developmental protein SEPALLATA 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009398247.17e-71PREDICTED: truncated transcription factor CAULIFLOWER A-like
SwissprotQ388762e-68AGL8_ARATH; Agamous-like MADS-box protein AGL8
TrEMBLA0A0K9PZB21e-157A0A0K9PZB2_Z
STRINGGSMUA_Achr4P23540_0012e-70(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP115137113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.11e-69AGAMOUS-like 8